View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY834782 93 bp RNA linear VRL 23-MAR-2005
DEFINITION HIV-1 clone 01202T072mo.7 gag protein (gag) gene, partial cds
ACCESSION AY834782
VERSION AY834782.1 GI:57470783
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 93)
Show all sequences for reference 1
AUTHORS Betts,M.R., Exley,B., Price,D.A., Bansal,A., Camacho,Z.T.,
Teaberry,V., West,S.M., Ambrozak,D.R., Tomaras,G., Roederer,M.,
Kilby,J.M., Tartaglia,J., Belshe,R., Gao,F., Douek,D.C.,
Weinhold,K.J., Koup,R.A., Goepfert,P. and Ferrari,G.
TITLE Characterization of functional and phenotypic changes in anti-Gag
vaccine-induced T cell responses and their role in protection after
HIV-1 infection
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 102 (12), 4512-4517 (2005)
PUBMED 15753288
REFERENCE 2 (bases 1 to 93)
Show all sequences for reference 2
AUTHORS Betts,M.R., Exley,B., Price,D.A., Bansal,A., Camacho,Z.T.,
Teaberry,V., West,S.M., Ambrozak,D.R., Tomaras,G., Roederero,M.,
Kilby,M.J., Tartaglia,J., Belshe,R., Gao,F., Douek,D.C.,
Weinhold,K.J., Koup,R.A., Goepfert,P. and Ferrari,G.
TITLE Failure of vaccine-induced HIV-specific T cell responses to protect
against HIV infection
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 93)
Show all sequences for reference 3
AUTHORS Betts,M.R., Exley,B., Price,D.A., Bansal,A., Camacho,Z.T.,
Teaberry,V., West,S.M., Ambrozak,D.R., Tomaras,G., Roederero,M.,
Kilby,M.J., Tartaglia,J., Belshe,R., Gao,F., Douek,D.C.,
Weinhold,K.J., Koup,R.A., Goepfert,P. and Ferrari,G.
TITLE Direct Submission
JOURNAL Submitted (22-NOV-2004) Department of Surgery, Duke University
Medical Center, PO Box 2926, Durham, NC 27710, USA
FEATURES Location/Qualifiers
source 1..93
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolation_source="patient 01202T07"
/db_xref="taxon:11676"
/clone="01202T072mo.7"
/country="USA"
gene <1..>93
/gene="gag"
CDS <1..>93
/gene="gag"
/note="p24"
/codon_start="1"
/transl_table="1"
/product="gag protein"
/protein_id="AAW50716.1"
/db_xref="GI:57470784"
/translation="MTNNPPIPVGEIYKRWIILGLNKIVRMYSPT"
BASE COUNT 39 a 16 c 16 g 22 t
ORIGIN
1 atgacaaata atccacctat cccagtagga gaaatctata aaagatggat aatcctggga
61 ttaaataaaa tagtaaggat gtatagccct acc
//
last modified: Tue May 31 10:56 2022