View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY756876 1302 bp RNA linear VRL 13-JUN-2005
DEFINITION HIV-1 isolate 9015 from Malawi pol protein (pol) gene, partial cds
ACCESSION AY756876
VERSION AY756876.1 GI:59064958
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 1302)
Show all sequences for reference 1
AUTHORS Eshleman,S.H., Hoover,D.R., Chen,S., Hudelson,S.E., Guay,L.A.,
Mwatha,A., Fiscus,S.A., Mmiro,F., Musoke,P., Jackson,J.B.,
Kumwenda,N. and Taha,T.
TITLE Nevirapine (NVP) Resistance in Women with HIV-1 Subtype C, Compared
with Subtypes A and D, after the Administration of Single-Dose NVP
JOURNAL J. Infect. Dis. 192 (1), 30-36 (2005)
PUBMED 15942891
REFERENCE 2 (bases 1 to 1302)
Show all sequences for reference 2
AUTHORS Eshleman,S.H.
TITLE Direct Submission
JOURNAL Submitted (22-SEP-2004) Pathology, The Johns Hopkins Medical
Institutions, 720 Rutland Avenue Ross Building 646, Baltimore, MD
21205, USA
COMMENT These sequences are from the NVAZ, a mother/infant study conducted
in Malawi in 2000-2002 (info from Taha et al. 2003 PMID#14568737).
Thus the sample collection date is annotated as 2000-2002.
FEATURES Location/Qualifiers
source 1..1302
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="9015"
/db_xref="taxon:11676"
/country="Malawi"
/note="subtype: C"
gene <1..>1302
/gene="pol"
CDS <1..>1302
/gene="pol"
/note="encodes protease and reverse transcriptase"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="AAW84142.1"
/db_xref="GI:59064959"
/translation="PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEINLPGKWKP
KMIGGIGGFIKVRQYDQILIEICGKKAIGXVLVGPTPVNIIGRNMLTQLGCTLNFPIS
PVXTXPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPVF
AIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKXKSVTVLDVGDAYFSVP
LDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPXIFQSSMTKILEPFRAQNPE
VVIXQYMDDLYVXSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELH
PDKWTVQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIV
PLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGHD"
BASE COUNT 506 a 215 c 281 g 292 t 8 other
ORIGIN
1 cctcaaatca ctctttggca gcgacccctt gtcacaataa aagtaggggg ccagataaag
61 gaggctctct tagacacagg agcagatgac acagtattag aagaaataaa tttgccagga
121 aaatggaaac caaaaatgat aggaggaatt ggaggtttta tcaaagtaag acagtatgat
181 caaatactta tagaaatttg tggaaaaaag gctataggtw cagtattggt gggacctaca
241 cctgttaaca taattggaag aaatatgttg actcagcttg gatgtacact aaattttcca
301 atcagtcccg ttraaactrt accagtaaaa ttaaagccag gaatggatgg cccaaaggtt
361 aaacaatggc cattgacaga agagaaaata aaagcattaa cagcaatttg tgacgaaatg
421 gagaaggaag gaaaaattac aaaaattggg cctgaaaatc catataacac tccagtattt
481 gccataaaaa agaaggacag tactaagtgg agaaaattag tagatttcag ggaactcaat
541 aaaagaactc aagatttttg ggaggttcaa ttaggaatac cacacccagc agggttaaaa
601 aagaamaaat cagtgacagt actggatgtg ggggatgcat atttttcagt tcctttagat
661 gaagacttca ggaaatatac tgcattcacc atacctagta taaacaatga gacaccaggg
721 attagatatc aatataatgt gcttccacag ggatggaaag gatcaccakc aatattccag
781 agtagcatga caaaaatctt agagcccttt agagcacaaa atccagaagt agtcatctrt
841 caatatatgg atgacttgta tgtagsatct gacttagaaa tagggcaaca tagagcaaag
901 atagaggagt taagagaaca tctgttaaag tggggattta ccacaccaga caagaaacat
961 caaaaggaac ccccatttct ttggatgggg tatgaactcc atcctgacaa atggacagta
1021 cagcctatac agctaccaga aaaggacagc tggactgtca atgatataca aaagttagtg
1081 ggaaaattaa actgggcaag tcagatttac ccagggatta aagtaaggca actttgtaaa
1141 ctccttaggg gggccaaagc actaacagac atagtaccac taactgaaga agcagaatta
1201 gaattggcag agaayaggga aattctaaaa gaaccagtgc atggagtata ctatgaccca
1261 tcaaaagact tgatagctga aatacagaaa cagggacatg at
//
last modified: Tue May 31 10:56 2022