View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY731921 249 bp DNA linear VRL 29-NOV-2004
DEFINITION HIV-1 isolate 00CHNHN56 from China gag protein (gag) gene, partial
cds
ACCESSION AY731921
VERSION AY731921.1 GI:54300889
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 249)
Show all sequences for reference 1
AUTHORS Zhang,L., Chen,Z., Cao,Y., Yu,J., Li,G., Yu,W., Yin,N., Mei,S.,
Li,L., Balfe,P., He,T., Ba,L., Zhang,F., Lin,H.H., Yuen,M.F.,
Lai,C.L. and Ho,D.D.
TITLE Molecular Characterization of Human Immunodeficiency Virus Type 1
and Hepatitis C Virus in Paid Blood Donors and Injection Drug Users
in China
JOURNAL J. Virol. 78 (24), 13591-13599 (2004)
PUBMED 15564470
REFERENCE 2 (bases 1 to 249)
Show all sequences for reference 2
AUTHORS Zhang,L.
TITLE Direct Submission
JOURNAL Submitted (24-AUG-2004) The Rockefeller University, Aaron Diamond
AIDS Research Center, 455 First Avenue, 7th Floor, New York, NY
10016, USA
FEATURES Location/Qualifiers
source 1..249
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="00CHNHN56"
/db_xref="taxon:11676"
/country="China"
gene <1..>249
/gene="gag"
CDS <1..>249
/gene="gag"
/note="p17 region"
/codon_start="1"
/transl_table="1"
/product="gag protein"
/protein_id="AAV32942.1"
/db_xref="GI:54300890"
/translation="KHIVWASRELERFAVNPGLLETSEGCRQILEQLQPSLQTGSEEL
RSLFNTIATLYCVHRRIEIKDTKEALEKIEEEQNKSKKK"
BASE COUNT 104 a 44 c 54 g 47 t
ORIGIN
1 aaacatatag tatgggcaag cagggagcta gaacgattcg cagttaatcc tggcctgtta
61 gaaacatcag aaggctgtag acaaatactg gaacagctac aaccatccct tcagacagga
121 tcagaagaac ttagatcatt attcaataca atagcaaccc tctattgtgt gcatcgaagg
181 atagagataa aagacaccaa ggaagcttta gagaaaatag aggaagagca aaacaaaagt
241 aagaaaaag
//
last modified: Tue May 31 10:56 2022