View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY605620 675 bp RNA linear VRL 30-APR-2005
DEFINITION HIV-1 isolate TH217_RT from Thailand pol protein (pol) gene,
partial cds
ACCESSION AY605620
VERSION AY605620.1 GI:51342862
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 675)
Show all sequences for reference 1
AUTHORS Sirivichayakul,S. and Phanuphak,P.
TITLE RT and protease sequences from HIV-1 non-B infected persons from
Thailand
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 675)
Show all sequences for reference 2
AUTHORS Sirivichayakul,S. and Phanuphak,P.
TITLE Direct Submission
JOURNAL Submitted (23-APR-2004) Division of Allergy and Clinical
Immunology, Department of Medicine, Faculty of Medicine,
Chulalongkorn University, Rama IV Road, Bangkok 10330, Thailand
REFERENCE 3
Show all sequences for reference 3
AUTHORS Kantor,R., Katzenstein,D.A., Efron,B., Carvalho,A.P., Wynhoven,B.,
Cane,P., Clarke,J., Sirivichayakul,S., Soares,M.A., Snoeck,J.,
Pillay,C., Rudich,H., Rodrigues,R., Holguin,A., Ariyoshi,K.,
Bouzas,M.B., Cahn,P., Sugiura,W., Soriano,V., Brigido,L.F.,
Grossman,Z., Morris,L., Vandamme,A.M., Tanuri,A., Phanuphak,P.,
Weber,J.N., Pillay,D., Harrigan,P.R., Camacho,R., Schapiro,J.M. and
Shafer,R.W.
TITLE Impact of HIV-1 Subtype and Antiretroviral Therapy on Protease and
Reverse Transcriptase Genotype: Results of a Global Collaboration
JOURNAL PLoS Med 2 (4), E112 (2005)
PUBMED 15839752
COMMENT Subtype assigned by HIV database staff [JM 5/07].
FEATURES Location/Qualifiers
source 1..675
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="TH217_RT"
/db_xref="taxon:11676"
/country="Thailand"
gene <1..>675
/gene="pol"
CDS <1..>675
/gene="pol"
/note="encodes reverse transcriptase and protease"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="AAU01476.1"
/db_xref="GI:51342863"
/translation="WPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPIFAIKKKE
GTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFR
KYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVIYQY
MDDLYVGSDLEIGQHRTKIEELRAHLLSWGFFTPDKKHQKEPPFLWMGYELHPDRWTV
QPIELPE"
BASE COUNT 263 a 114 c 143 g 155 t
ORIGIN
1 tggccattga cagaagagaa aataaaagca ttaacagaaa tttgtaaaga attggaagag
61 gaaggaaaga tttcaaaaat tgggcctgaa aatccataca atactccaat atttgctata
121 aagaaaaagg aaggcactaa atggaggaaa ttagtagatt tcagagagct caataaaaga
181 actcaggact tttgtgaagt tcaattagga ataccgcatc cagcaggttt aaaaaagaaa
241 aaatcagtaa cagtactaga tgtgggagat gcatattttt cagttcctct agatgagagc
301 tttagaaagt atactgcatt caccatacct agtataaaca atgagacacc aggaatcaga
361 tatcagtaca atgtgctgcc acagggatgg aaaggatcac cggcaatatt ccagagtagc
421 atgacaaaaa tcttagagcc ctttagagca aaaaatccag aaatagttat ctatcaatac
481 atggatgact tgtatgtagg atctgactta gaaatagggc agcacagaac aaagatagag
541 gagctaagag ctcatctact gagctgggga ttttttacac cagacaaaaa gcatcagaag
601 gaacctccat tcctttggat gggatatgaa ctccatcctg acagatggac agtccagcct
661 atagaactgc cagaa
//
last modified: Tue May 31 10:56 2022