View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY605555 702 bp RNA linear VRL 30-APR-2005
DEFINITION HIV-1 isolate TH142_RT from Thailand pol protein (pol) gene,
partial cds
ACCESSION AY605555
VERSION AY605555.1 GI:51342732
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 702)
Show all sequences for reference 1
AUTHORS Sirivichayakul,S. and Phanuphak,P.
TITLE RT and protease sequences from HIV-1 non-B infected persons from
Thailand
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 702)
Show all sequences for reference 2
AUTHORS Sirivichayakul,S. and Phanuphak,P.
TITLE Direct Submission
JOURNAL Submitted (23-APR-2004) Division of Allergy and Clinical
Immunology, Department of Medicine, Faculty of Medicine,
Chulalongkorn University, Rama IV Road, Bangkok 10330, Thailand
REFERENCE 3
Show all sequences for reference 3
AUTHORS Kantor,R., Katzenstein,D.A., Efron,B., Carvalho,A.P., Wynhoven,B.,
Cane,P., Clarke,J., Sirivichayakul,S., Soares,M.A., Snoeck,J.,
Pillay,C., Rudich,H., Rodrigues,R., Holguin,A., Ariyoshi,K.,
Bouzas,M.B., Cahn,P., Sugiura,W., Soriano,V., Brigido,L.F.,
Grossman,Z., Morris,L., Vandamme,A.M., Tanuri,A., Phanuphak,P.,
Weber,J.N., Pillay,D., Harrigan,P.R., Camacho,R., Schapiro,J.M. and
Shafer,R.W.
TITLE Impact of HIV-1 Subtype and Antiretroviral Therapy on Protease and
Reverse Transcriptase Genotype: Results of a Global Collaboration
JOURNAL PLoS Med 2 (4), E112 (2005)
PUBMED 15839752
COMMENT Subtype assigned by HIV database staff [JM 5/07].
FEATURES Location/Qualifiers
source 1..702
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="TH142_RT"
/db_xref="taxon:11676"
/country="Thailand"
gene <1..>702
/gene="pol"
CDS <1..>702
/gene="pol"
/note="encodes reverse transcriptase and protease"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="AAU01411.1"
/db_xref="GI:51342733"
/translation="PKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFA
IKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEM
VIYQYMDDLYVGNDLAIGQHRRKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHP
DKWTVQPIELPEKDSW"
BASE COUNT 280 a 123 c 146 g 153 t
ORIGIN
1 cccaaggtta aacagtggcc attgacagaa gaaaaaataa aagcattaac agaaatttgt
61 aaagagatgg aagaggaagg aaaaatctca aaaattgggc ctgaaaatcc atacaatact
121 ccagtatttg ctataaagaa aaaggacagc accaaatgga ggaaattagt agatttcaga
181 gagctcaata aaagaactca ggacttttgg gaagttcaat taggaatacc gcatcccgca
241 ggtttaaaaa agaaaaaatc agtaacagta ctagatgtgg gagatgcata tttttcagtt
301 cctttagatg aaagctttag aaaatatact gcattcacca tacctagtat aaacaatgag
361 accccaggaa tcagatatca gtacaacgtg ctgccacagg gatggaaagg atcaccagca
421 atattccaaa gtagcatgac aaaaatctta gagcccttta gaataaaaaa tccagaaatg
481 gttatctatc aatacatgga tgacttgtat gtaggaaatg atttagcaat aggccagcac
541 agaagaaaaa tagaggagct gagagctcat ctattgagct ggggatttac tacaccagac
601 aaaaaacatc agaaggagcc tccattcctg tggatgggat atgaactcca tcctgacaaa
661 tggacagtcc agcctataga actgccagaa aaagacagct gg
//
last modified: Tue May 31 10:56 2022