View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY348415 597 bp RNA linear VRL 15-APR-2004
DEFINITION HIV-1 isolate p7p087 clone 7 from USA envelope glycoprotein (env)
gene, partial cds
ACCESSION AY348415
VERSION AY348415.1 GI:33590783
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 597)
Show all sequences for reference 1
AUTHORS Shankarappa,R., Margolick,J.B., Gange,S., Gange,S.J., Rodrigo,A.G.,
Upchurch,D., Farzadegan,H., Gupta,P., Rinaldo,C.R., Learn,G.H.,
He,X., Huang,X.-L. and Mullins,J.I.
TITLE Consistent viral evolutionary changes associated with the
progression of human immunodeficiency virus type 1 infection
JOURNAL J. Virol. 73 (12), 10489-10502 (1999)
PUBMED 10559367
REFERENCE 2 (bases 1 to 597)
Show all sequences for reference 2
AUTHORS Shriner,D., Shankarappa,R., Jensen,M.A., Nickle,D.C., Mittler,J.E.,
Margolick,J.B. and Mullins,J.I.
TITLE Influence of Random Genetic Drift on Human Immunodeficiency Virus
Type 1 env Evolution During Chronic Infection
JOURNAL Genetics 166 (3), 1155-1164 (2004)
PUBMED 15082537
REFERENCE 3 (bases 1 to 597)
Show all sequences for reference 3
AUTHORS Shriner,D., Shankarappa,R., Jensen,M.A., Nickle,D.C., Mittler,J.E.,
Margolick,J.B. and Mullins,J.I.
TITLE Direct Submission
JOURNAL Submitted (23-JUL-2003) Department of Microbiology, University of
Washington, Box 358070, Seattle, WA 98195-8070, USA
REFERENCE 4
Show all sequences for reference 4
AUTHORS Jensen,M.A., Li,F., van 't Wout,A.B., Nickle,D.C., Shriner,D.,
He,H.-X., McLaughlin,S., Shankarappa,R., Margolick,J.B. and
Mullins,J.I.
CONSRTM Multicenter AIDS Cohort Study
TITLE Improved Coreceptor Usage Prediction and Genotypic Monitoring of
R5-to-X4 Transition by Motif Analysis of Human Immunodeficiency
Virus Type 1 env V3 Loop Sequences
JOURNAL J. Virol. 77 (24), 13376-13388 (2003)
PUBMED 14645592
COMMENT Sequences AF204402-204670, AF137629-138703, and AY348544-348333:
the 3-digit number in each sample name is months
post-seroconversion. Sampling years are estimated based on
enrollment in 1983-84 incremented by months post-seroconversion.
Data on viral load, CD4, and CD8 provided by J. Mullins [JM 3/06]
FEATURES Location/Qualifiers
source 1..597
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="p7p087"
/db_xref="taxon:11676"
/clone="7"
/country="USA"
gene <1..>597
/gene="env"
/note="gp120"
CDS <1..>597
/gene="env"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAQ22854.1"
/db_xref="GI:33590784"
/translation="EKDVVIRSENFTNNAKTIIVQLKESVIINCTRYNNNTRKSIHIG
PGRAFYATEDVVGNIRQAHCNISRTKWNNTLKQIVKKLQEQFGNKTIIFKQSSGGDPE
IVMHSFNCGGEFFYCNTTELFNSTWEFNSTWNGTTEPDSNITLPCRIKQIISRWQEVG
KAMYAPPIKGLINCPSNITGLLLTRDGGKNNTNETFRPG"
BASE COUNT 247 a 95 c 116 g 139 t
ORIGIN
1 gaaaaagatg tagtaattag atctgaaaat ttcacaaaca atgctaaaac cataatagta
61 cagctgaagg agtctgtaat aattaattgt acaagataca acaacaatac aagaaaaagt
121 atacacatag gaccagggag agcattttat gcaacagaag acgtagtagg aaatataaga
181 caagcacatt gtaacattag tagaacaaaa tggaataaca ctttaaagca gatagttaaa
241 aaattacaag aacaatttgg gaataaaaca ataatcttta agcaatcctc aggaggggac
301 ccagaaattg taatgcacag ttttaattgt ggaggggaat ttttctactg taatacaaca
361 gagctgttta acagtacttg ggagtttaac agtacttgga atggtaccac agagccagat
421 agcaatatca cactcccatg cagaataaaa caaattataa gcaggtggca ggaagtagga
481 aaagcaatgt atgcccctcc catcaaagga ttaattaact gtccctcaaa tattacaggg
541 ctgttattaa caagagatgg tggtaagaac aacaccaacg agacctttag acctgga
//
last modified: Tue May 31 10:56 2022