View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY348399 621 bp RNA linear VRL 15-APR-2004
DEFINITION HIV-1 isolate p3c091 clone 3 from USA envelope glycoprotein (env)
gene, partial cds
ACCESSION AY348399
VERSION AY348399.1 GI:33590751
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 621)
Show all sequences for reference 1
AUTHORS Shankarappa,R., Margolick,J.B., Gange,S., Gange,S.J., Rodrigo,A.G.,
Upchurch,D., Farzadegan,H., Gupta,P., Rinaldo,C.R., Learn,G.H.,
He,X., Huang,X.-L. and Mullins,J.I.
TITLE Consistent viral evolutionary changes associated with the
progression of human immunodeficiency virus type 1 infection
JOURNAL J. Virol. 73 (12), 10489-10502 (1999)
PUBMED 10559367
REFERENCE 2 (bases 1 to 621)
Show all sequences for reference 2
AUTHORS Shriner,D., Shankarappa,R., Jensen,M.A., Nickle,D.C., Mittler,J.E.,
Margolick,J.B. and Mullins,J.I.
TITLE Influence of Random Genetic Drift on Human Immunodeficiency Virus
Type 1 env Evolution During Chronic Infection
JOURNAL Genetics 166 (3), 1155-1164 (2004)
PUBMED 15082537
REFERENCE 3 (bases 1 to 621)
Show all sequences for reference 3
AUTHORS Shriner,D., Shankarappa,R., Jensen,M.A., Nickle,D.C., Mittler,J.E.,
Margolick,J.B. and Mullins,J.I.
TITLE Direct Submission
JOURNAL Submitted (23-JUL-2003) Department of Microbiology, University of
Washington, Box 358070, Seattle, WA 98195-8070, USA
REFERENCE 4
Show all sequences for reference 4
AUTHORS Jensen,M.A., Li,F., van 't Wout,A.B., Nickle,D.C., Shriner,D.,
He,H.-X., McLaughlin,S., Shankarappa,R., Margolick,J.B. and
Mullins,J.I.
CONSRTM Multicenter AIDS Cohort Study
TITLE Improved Coreceptor Usage Prediction and Genotypic Monitoring of
R5-to-X4 Transition by Motif Analysis of Human Immunodeficiency
Virus Type 1 env V3 Loop Sequences
JOURNAL J. Virol. 77 (24), 13376-13388 (2003)
PUBMED 14645592
COMMENT Sequences AF204402-204670, AF137629-138703, and AY348544-348333:
the 3-digit number in each sample name is months
post-seroconversion. Sampling years are estimated based on
enrollment in 1983-84 incremented by months post-seroconversion.
Data on viral load, CD4, and CD8 provided by J. Mullins [JM 3/06]
FEATURES Location/Qualifiers
source 1..621
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="p3c091"
/db_xref="taxon:11676"
/clone="3"
/country="USA"
gene <1..>621
/gene="env"
/note="gp120"
CDS <1..>621
/gene="env"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAQ22838.1"
/db_xref="GI:33590752"
/translation="EEVVIRSENFSDNAKTIIVQLKDPVNITCIRPNNNTRKSIRIGP
GRAVYATDRIIGNIRQAHCNISREKWHRTLEQIVEKLREKFGNDTTIVFNRSSGGDPE
IVMHSFNCGGEFFYCNSAQLFNSTWNSTQPLNDTGGSNNNTITLQCKIKQIINMWQEV
GKAMYAPPIQGLIRCSSNITGLLLTRDGGTDNNGTGSQNKTEIFRPG"
BASE COUNT 251 a 102 c 125 g 143 t
ORIGIN
1 gaagaggtag taattagatc tgaaaatttc tcagacaatg ctaaaaccat aatagtacag
61 ctgaaagacc ctgtaaacat tacttgtata agacccaaca acaatacaag aaaaagtata
121 cgtataggac cggggagagc agtttatgca acagatagaa taataggaaa tataagacaa
181 gcacattgta acattagtag agaaaaatgg catagaactt tagaacagat agttgaaaaa
241 ttaagagaaa aatttgggaa cgatacaaca atagtcttta atcgatcctc aggaggggac
301 ccagaaattg taatgcacag ttttaattgt ggaggggaat ttttctactg taattcagca
361 caactgttta atagtacttg gaattcaaca caaccgttaa atgatactgg cgggtcaaat
421 aacaacacta tcacactcca atgcaaaata aaacaaatta taaacatgtg gcaggaagta
481 ggaaaagcaa tgtatgcccc tcccatccaa ggactcatta gatgttcatc aaatattaca
541 gggctgctat taacaagaga tggtggtaca gacaacaatg ggacagggag ccagaataag
601 acagagatct tcagacctgg a
//
last modified: Tue May 31 10:56 2022