HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    AY348399		     621 bp    RNA     linear	VRL 15-APR-2004
DEFINITION  HIV-1 isolate p3c091 clone 3 from USA envelope glycoprotein (env)
	    gene, partial cds
ACCESSION   AY348399
VERSION     AY348399.1 GI:33590751
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 621)
            Show all sequences for reference 1
  AUTHORS   Shankarappa,R., Margolick,J.B., Gange,S., Gange,S.J., Rodrigo,A.G.,
	    Upchurch,D., Farzadegan,H., Gupta,P., Rinaldo,C.R., Learn,G.H.,
	    He,X., Huang,X.-L. and Mullins,J.I.
  TITLE     Consistent viral evolutionary changes associated with the
	    progression of human immunodeficiency virus type 1 infection
  JOURNAL   J. Virol. 73 (12), 10489-10502 (1999)
  PUBMED    10559367
REFERENCE   2 (bases 1 to 621)
            Show all sequences for reference 2
  AUTHORS   Shriner,D., Shankarappa,R., Jensen,M.A., Nickle,D.C., Mittler,J.E.,
	    Margolick,J.B. and Mullins,J.I.
  TITLE     Influence of Random Genetic Drift on Human Immunodeficiency Virus
	    Type 1 env Evolution During Chronic Infection
  JOURNAL   Genetics 166 (3), 1155-1164 (2004)
  PUBMED    15082537
REFERENCE   3 (bases 1 to 621)
            Show all sequences for reference 3
  AUTHORS   Shriner,D., Shankarappa,R., Jensen,M.A., Nickle,D.C., Mittler,J.E.,
	    Margolick,J.B. and Mullins,J.I.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUL-2003) Department of Microbiology, University of
	    Washington, Box 358070, Seattle, WA 98195-8070, USA
REFERENCE   4
            Show all sequences for reference 4
  AUTHORS   Jensen,M.A., Li,F., van 't Wout,A.B., Nickle,D.C., Shriner,D.,
	    He,H.-X., McLaughlin,S., Shankarappa,R., Margolick,J.B. and
	    Mullins,J.I.
  CONSRTM   Multicenter AIDS Cohort Study
  TITLE     Improved Coreceptor Usage Prediction and Genotypic Monitoring of
	    R5-to-X4 Transition by Motif Analysis of Human Immunodeficiency
	    Virus Type 1 env V3 Loop Sequences
  JOURNAL   J. Virol. 77 (24), 13376-13388 (2003)
  PUBMED    14645592
COMMENT     Sequences AF204402-204670, AF137629-138703, and AY348544-348333:
	    the 3-digit number in each sample name is months
	    post-seroconversion. Sampling years are estimated based on
	    enrollment in 1983-84 incremented by months post-seroconversion.
	    Data on viral load, CD4, and CD8 provided by J. Mullins [JM 3/06]
FEATURES             Location/Qualifiers
     source	     1..621
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic RNA"
		     /isolate="p3c091"
		     /db_xref="taxon:11676"
		     /clone="3"
		     /country="USA"
     gene	     <1..>621
		     /gene="env"
		     /note="gp120"
     CDS	     <1..>621
		     /gene="env"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AAQ22838.1"
		     /db_xref="GI:33590752"
		     /translation="EEVVIRSENFSDNAKTIIVQLKDPVNITCIRPNNNTRKSIRIGP
		     GRAVYATDRIIGNIRQAHCNISREKWHRTLEQIVEKLREKFGNDTTIVFNRSSGGDPE
		     IVMHSFNCGGEFFYCNSAQLFNSTWNSTQPLNDTGGSNNNTITLQCKIKQIINMWQEV
		     GKAMYAPPIQGLIRCSSNITGLLLTRDGGTDNNGTGSQNKTEIFRPG"
BASE COUNT	251 a	 102 c	  125 g    143 t
ORIGIN
       1 gaagaggtag taattagatc tgaaaatttc tcagacaatg ctaaaaccat aatagtacag 
      61 ctgaaagacc ctgtaaacat tacttgtata agacccaaca acaatacaag aaaaagtata 
     121 cgtataggac cggggagagc agtttatgca acagatagaa taataggaaa tataagacaa 
     181 gcacattgta acattagtag agaaaaatgg catagaactt tagaacagat agttgaaaaa 
     241 ttaagagaaa aatttgggaa cgatacaaca atagtcttta atcgatcctc aggaggggac 
     301 ccagaaattg taatgcacag ttttaattgt ggaggggaat ttttctactg taattcagca 
     361 caactgttta atagtacttg gaattcaaca caaccgttaa atgatactgg cgggtcaaat 
     421 aacaacacta tcacactcca atgcaaaata aaacaaatta taaacatgtg gcaggaagta 
     481 ggaaaagcaa tgtatgcccc tcccatccaa ggactcatta gatgttcatc aaatattaca 
     541 gggctgctat taacaagaga tggtggtaca gacaacaatg ggacagggag ccagaataag 
     601 acagagatct tcagacctgg a
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.