HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    AY348343		     621 bp    RNA     linear	VRL 15-APR-2004
DEFINITION  HIV-1 isolate p2p138 clone 11 from USA envelope glycoprotein (env)
	    gene, partial cds
ACCESSION   AY348343
VERSION     AY348343.1 GI:33590639
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 621)
            Show all sequences for reference 1
  AUTHORS   Shankarappa,R., Margolick,J.B., Gange,S., Gange,S.J., Rodrigo,A.G.,
	    Upchurch,D., Farzadegan,H., Gupta,P., Rinaldo,C.R., Learn,G.H.,
	    He,X., Huang,X.-L. and Mullins,J.I.
  TITLE     Consistent viral evolutionary changes associated with the
	    progression of human immunodeficiency virus type 1 infection
  JOURNAL   J. Virol. 73 (12), 10489-10502 (1999)
  PUBMED    10559367
REFERENCE   2 (bases 1 to 621)
            Show all sequences for reference 2
  AUTHORS   Shriner,D., Shankarappa,R., Jensen,M.A., Nickle,D.C., Mittler,J.E.,
	    Margolick,J.B. and Mullins,J.I.
  TITLE     Influence of Random Genetic Drift on Human Immunodeficiency Virus
	    Type 1 env Evolution During Chronic Infection
  JOURNAL   Genetics 166 (3), 1155-1164 (2004)
  PUBMED    15082537
REFERENCE   3 (bases 1 to 621)
            Show all sequences for reference 3
  AUTHORS   Shriner,D., Shankarappa,R., Jensen,M.A., Nickle,D.C., Mittler,J.E.,
	    Margolick,J.B. and Mullins,J.I.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUL-2003) Department of Microbiology, University of
	    Washington, Box 358070, Seattle, WA 98195-8070, USA
REFERENCE   4
            Show all sequences for reference 4
  AUTHORS   Jensen,M.A., Li,F., van 't Wout,A.B., Nickle,D.C., Shriner,D.,
	    He,H.-X., McLaughlin,S., Shankarappa,R., Margolick,J.B. and
	    Mullins,J.I.
  CONSRTM   Multicenter AIDS Cohort Study
  TITLE     Improved Coreceptor Usage Prediction and Genotypic Monitoring of
	    R5-to-X4 Transition by Motif Analysis of Human Immunodeficiency
	    Virus Type 1 env V3 Loop Sequences
  JOURNAL   J. Virol. 77 (24), 13376-13388 (2003)
  PUBMED    14645592
COMMENT     Sequences AF204402-204670, AF137629-138703, and AY348544-348333:
	    the 3-digit number in each sample name is months
	    post-seroconversion. Sampling years are estimated based on
	    enrollment in 1983-84 incremented by months post-seroconversion.
	    Data on viral load, CD4, and CD8 provided by J. Mullins [JM 3/06]
FEATURES             Location/Qualifiers
     source	     1..621
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic RNA"
		     /isolate="p2p138"
		     /db_xref="taxon:11676"
		     /clone="11"
		     /country="USA"
     gene	     <1..>621
		     /gene="env"
		     /note="gp120"
     CDS	     <1..>621
		     /gene="env"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AAQ22782.1"
		     /db_xref="GI:33590640"
		     /translation="EEEVVVRSENFSNNAKTIIVQLTEAVEINCTRPNNNTRKGIHIG
		     PGRAVFATDRIIGNIRQAHCNISKAKWNDTLKQVIKKLGEQFENTTKIVFNQSSGGDP
		     EIVMHSFNCGGEFFYCKTTQLFNSTWARGNGNGTGTWNATKMPNNNGETIILPCKIKQ
		     IVNMWQEVGKAMYAPPIGGQIRCSSNITGLLLTSDGGGKENETFRPG"
BASE COUNT	248 a	  95 c	  133 g    145 t
ORIGIN
       1 gaagaagagg tagtagttag gtctgaaaat ttctcaaaca atgctaaaac cataatagta 
      61 cagctgacgg aagctgtaga aattaattgt acaagaccca acaacaacac aagaaaaggt 
     121 atacatatag gaccagggag agcagttttt gcaacagaca gaataatagg aaatataaga 
     181 caagcacatt gtaacattag taaagcaaaa tggaatgaca ctttaaaaca ggtaattaaa 
     241 aaattaggcg aacaatttga gaatacaaca aaaatagtct ttaatcaatc ctcaggaggg 
     301 gacccagaaa ttgtaatgca cagttttaat tgtggagggg aatttttcta ctgtaagaca 
     361 acacaactgt ttaatagtac ttgggctagg ggtaatggta atggtactgg tacttggaat 
     421 gctactaaaa tgccaaataa caatggagaa actatcatac tcccatgcaa aataaaacaa 
     481 attgtaaaca tgtggcagga agtaggaaaa gcaatgtatg cccctcccat tggaggacaa 
     541 attagatgtt catcaaatat tacagggctg ctactaacaa gcgatggtgg tggtaaggag 
     601 aatgagacct tcagacctgg a
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.