View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY348343 621 bp RNA linear VRL 15-APR-2004
DEFINITION HIV-1 isolate p2p138 clone 11 from USA envelope glycoprotein (env)
gene, partial cds
ACCESSION AY348343
VERSION AY348343.1 GI:33590639
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 621)
Show all sequences for reference 1
AUTHORS Shankarappa,R., Margolick,J.B., Gange,S., Gange,S.J., Rodrigo,A.G.,
Upchurch,D., Farzadegan,H., Gupta,P., Rinaldo,C.R., Learn,G.H.,
He,X., Huang,X.-L. and Mullins,J.I.
TITLE Consistent viral evolutionary changes associated with the
progression of human immunodeficiency virus type 1 infection
JOURNAL J. Virol. 73 (12), 10489-10502 (1999)
PUBMED 10559367
REFERENCE 2 (bases 1 to 621)
Show all sequences for reference 2
AUTHORS Shriner,D., Shankarappa,R., Jensen,M.A., Nickle,D.C., Mittler,J.E.,
Margolick,J.B. and Mullins,J.I.
TITLE Influence of Random Genetic Drift on Human Immunodeficiency Virus
Type 1 env Evolution During Chronic Infection
JOURNAL Genetics 166 (3), 1155-1164 (2004)
PUBMED 15082537
REFERENCE 3 (bases 1 to 621)
Show all sequences for reference 3
AUTHORS Shriner,D., Shankarappa,R., Jensen,M.A., Nickle,D.C., Mittler,J.E.,
Margolick,J.B. and Mullins,J.I.
TITLE Direct Submission
JOURNAL Submitted (23-JUL-2003) Department of Microbiology, University of
Washington, Box 358070, Seattle, WA 98195-8070, USA
REFERENCE 4
Show all sequences for reference 4
AUTHORS Jensen,M.A., Li,F., van 't Wout,A.B., Nickle,D.C., Shriner,D.,
He,H.-X., McLaughlin,S., Shankarappa,R., Margolick,J.B. and
Mullins,J.I.
CONSRTM Multicenter AIDS Cohort Study
TITLE Improved Coreceptor Usage Prediction and Genotypic Monitoring of
R5-to-X4 Transition by Motif Analysis of Human Immunodeficiency
Virus Type 1 env V3 Loop Sequences
JOURNAL J. Virol. 77 (24), 13376-13388 (2003)
PUBMED 14645592
COMMENT Sequences AF204402-204670, AF137629-138703, and AY348544-348333:
the 3-digit number in each sample name is months
post-seroconversion. Sampling years are estimated based on
enrollment in 1983-84 incremented by months post-seroconversion.
Data on viral load, CD4, and CD8 provided by J. Mullins [JM 3/06]
FEATURES Location/Qualifiers
source 1..621
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="p2p138"
/db_xref="taxon:11676"
/clone="11"
/country="USA"
gene <1..>621
/gene="env"
/note="gp120"
CDS <1..>621
/gene="env"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAQ22782.1"
/db_xref="GI:33590640"
/translation="EEEVVVRSENFSNNAKTIIVQLTEAVEINCTRPNNNTRKGIHIG
PGRAVFATDRIIGNIRQAHCNISKAKWNDTLKQVIKKLGEQFENTTKIVFNQSSGGDP
EIVMHSFNCGGEFFYCKTTQLFNSTWARGNGNGTGTWNATKMPNNNGETIILPCKIKQ
IVNMWQEVGKAMYAPPIGGQIRCSSNITGLLLTSDGGGKENETFRPG"
BASE COUNT 248 a 95 c 133 g 145 t
ORIGIN
1 gaagaagagg tagtagttag gtctgaaaat ttctcaaaca atgctaaaac cataatagta
61 cagctgacgg aagctgtaga aattaattgt acaagaccca acaacaacac aagaaaaggt
121 atacatatag gaccagggag agcagttttt gcaacagaca gaataatagg aaatataaga
181 caagcacatt gtaacattag taaagcaaaa tggaatgaca ctttaaaaca ggtaattaaa
241 aaattaggcg aacaatttga gaatacaaca aaaatagtct ttaatcaatc ctcaggaggg
301 gacccagaaa ttgtaatgca cagttttaat tgtggagggg aatttttcta ctgtaagaca
361 acacaactgt ttaatagtac ttgggctagg ggtaatggta atggtactgg tacttggaat
421 gctactaaaa tgccaaataa caatggagaa actatcatac tcccatgcaa aataaaacaa
481 attgtaaaca tgtggcagga agtaggaaaa gcaatgtatg cccctcccat tggaggacaa
541 attagatgtt catcaaatat tacagggctg ctactaacaa gcgatggtgg tggtaaggag
601 aatgagacct tcagacctgg a
//
last modified: Tue May 31 10:56 2022