View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY288902 488 bp DNA linear VRL 02-FEB-2004
DEFINITION HIV-1 isolate 02HBbd3 from China gag protein (gag) gene, partial
cds
ACCESSION AY288902
VERSION AY288902.1 GI:34305436
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 488)
Show all sequences for reference 1
AUTHORS Su,B., Liu,L., Wang,F., Gui,X., Zhao,M., Tien,P., Zhang,L. and
Chen,Z.
TITLE HIV-1 subtype B' dictates the AIDS epidemic among paid blood donors
in the Henan and Hubei provinces of China
JOURNAL AIDS 17 (17), 2515-2520 (2003)
PUBMED 14600524
REFERENCE 2 (bases 1 to 488)
Show all sequences for reference 2
AUTHORS Su,B., Liu,L., Wang,F., Gui,X., Zhao,M., Tien,P., Zhang,L. and
Chen,Z.
TITLE Direct Submission
JOURNAL Submitted (02-MAY-2003) Modern Virology Research Center, College of
Life Sciences, Wuhan University, Wuhan, Hubei 430072, P.R. China
FEATURES Location/Qualifiers
source 1..488
/organism="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="02HBbd3"
/db_xref="taxon:11676"
/country="China: Hubei"
gene 1..>488
/gene="gag"
CDS 1..>488
/gene="gag"
/codon_start="1"
/transl_table="1"
/product="gag protein"
/protein_id="AAQ63552.1"
/db_xref="GI:34305437"
/translation="MGARASVLSGGQLDRWEKIRLRPGGKKRYRLKHIVWASRELERF
AVNPGLLETSEGCRQILEQLQPSLQTGSEELRSLFNTVATLYCVHQRIEIKDTKEALD
KIEEEQNKSKKKAQQTAADKGNNSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVE
EKA"
BASE COUNT 195 a 84 c 119 g 90 t
ORIGIN
1 atgggtgcga gagcgtcagt attaagcggg ggacaattag atagatggga aaaaattcgg
61 ttaaggccag ggggaaagaa aagatataga ttaaaacata tagtatgggc aagcagggag
121 ctagaacgat tcgcagttaa tcctggcctg ttagaaacat cagaaggctg tagacaaata
181 ctggaacagc tacaaccatc ccttcagaca ggatctgaag aacttagatc attattcaat
241 acagtagcaa ccctctattg tgtgcatcaa aggatagaga taaaagacac caaggaagct
301 ttagataaga tagaggaaga gcaaaacaaa agtaagaaaa aggcacagca aacagcagct
361 gacaaaggaa acaacagcca ggtcagccaa aattacccta tagtgcaaaa ccttcagggg
421 caaatggtac atcaggccat atcacctaga actttaaatg catgggtaaa agtagtagaa
481 gagaaggc
//
last modified: Tue May 31 10:56 2022