View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY282326 217 bp DNA linear VRL 16-DEC-2004
DEFINITION HIV-1 clone WEAU016-05 tat protein (tat) gene, partial cds
ACCESSION AY282326
VERSION AY282326.1 GI:34421036
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 217)
Show all sequences for reference 1
AUTHORS Jones,N.A., Wei,X., Flower,D.R., Wong,M., Michor,F., Saag,M.S.,
Hahn,B.H., Nowak,M.A., Shaw,G.M. and Borrow,P.
TITLE Determinants of human immunodeficiency virus type 1 escape from the
primary CD8+ cytotoxic T lymphocyte response
JOURNAL J. Exp. Med. 200 (10), 1243-1256 (2004)
PUBMED 15545352
REFERENCE 2 (bases 1 to 217)
Show all sequences for reference 2
AUTHORS Jones,N.A., Wei,X., Flower,D.R., Wong,M., Michor,F., Saag,M.S.,
Hahn,B.H., Nowak,M.A., Shaw,G.M. and Borrow,P.
TITLE Direct Submission
JOURNAL Submitted (22-APR-2003) The Edward Jemmer Institute for Vaccine
Research, Copton, Newbury, Berkshire RG20 7NN, UK
REFERENCE 3
Show all sequences for reference 3
AUTHORS Wei,X., Decker,J.M., Wang,S., Hui,H., Kappes,J.C., Wu,X.,
Salazar-Gonzalez,J.F., Salazar,M.G., Kilby,J.M., Saag,M.S.,
Komarova,N.L., Nowak,M.A., Hahn,B.H., Kwong,P.D. and Shaw,G.M.
TITLE Antibody neutralization and escape by HIV-1
JOURNAL Nature 422 (6929), 307-312 (2003)
PUBMED 12646921
COMMENT For sequences from this patient, the first number in the sequence
name indicates the number of days since onset of symptoms; this
number was used as the basis of days post-seroconversion.
FEATURES Location/Qualifiers
source 1..217
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/db_xref="taxon:11676"
/clone="WEAU016-05"
/note="clones are labeled as patientxxx-yyy, where xxx is
the number of days after DFOSx and yyy is the clone
number"
gene 1..>217
/gene="tat"
CDS 1..>217
/gene="tat"
/codon_start="1"
/transl_table="1"
/product="tat protein"
/protein_id="AAQ67756.1"
/db_xref="GI:34421037"
/translation="MEPVDHRLEPWKHPGSQPKTACTNCYCKRCCFHCQVCFMTKGLG
ISYGRKKRRQRRRSPQNSQTHQDSLSKQ"
BASE COUNT 69 a 47 c 49 g 52 t
ORIGIN
1 atggagccag tagatcatag actagagccc tggaagcatc caggaagtca gcctaagact
61 gcttgtacca attgctattg taaaagatgt tgctttcatt gccaagtttg tttcatgaca
121 aaaggcttag gcatctccta tggcaggaag aagcggagac agcgacgaag atctcctcaa
181 aacagtcaga ctcatcaaga ttctctatca aagcagt
//
last modified: Tue May 31 10:56 2022