HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    AY156881		     793 bp    DNA     linear	VRL 22-OCT-2002
DEFINITION  HIV-1 clone V24 from USA envelope glycoprotein (env) gene, partial
	    cds
ACCESSION   AY156881
VERSION     AY156881.1 GI:24210231
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 793)
            Show all sequences for reference 1
  AUTHORS   Metzker,M.L., Ansari-Lari,M.A., Liu,X.M., Holder,D.J. and
	    Gibbs,R.A.
  TITLE     Quantitation of mixed-base populations of HIV-1 variants by
	    automated DNA sequencing with BODIPY dye-labeled primers
  JOURNAL   BioTechniques 25 (3), 446-447 (1998)
  PUBMED    9762443
REFERENCE   2 (bases 1 to 793)
            Show all sequences for reference 2
  AUTHORS   Metzker,M.L., Mindell,D.P., Liu,X.M., Ptak,R.G., Gibbs,R.A. and
	    Hillis,D.M.
  TITLE     Molecular evidence of HIV-1 transmission in a criminal case.
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (22), 14292-7 (2002)
  PUBMED    12388776
REFERENCE   3 (bases 1 to 793)
            Show all sequences for reference 3
  AUTHORS   Metzker,M.L., Liu,X.-M. and Gibbs,R.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-SEP-2002) Department of Molecular & Human Genetics,
	    Baylor College of Medicine, One Baylor Plaza, N1409, Houston, TX
	    77030, USA
COMMENT     There are 174 sequences in this group. A control group comprised of
	    28 individuals includes 26 env and 25 RT sequences taken in 1995.
	    Patient samples (66) include 51 env and 7 RT from 1995
	    (BCM,P01-50), 2 env and 6 RT from 1997 (MIC). Victim samples (57)
	    include 51 env and 2RT from 1995 (BCM,V01-50), and 2 env and 2 RT
	    from 1997 (MIC). This was a criminal case where a physician
	    intentionally infected the "victim" by intramuscular injection of
	    blood from the "patient". Victim was injected August, 1994 and
	    was seropositive in January, 1995.
FEATURES             Location/Qualifiers
     source	     1..793
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolation_source="whole blood PBMC"
		     /db_xref="taxon:11676"
		     /clone="V24"
		     /country="USA: Lafayette, LA"
     gene	     <1..>793
		     /gene="env"
     CDS	     <1..>793
		     /gene="env"
		     /codon_start="2"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AAN41608.1"
		     /db_xref="GI:24210232"
		     /translation="IRPTVSTQLLLNGSLAEKEVVIRSENFTNNAKTIIVQLTTPVEI
		     NCIRPNNNTRKSIPIGPGRALYTTGDIIGNIRKACCNISKAKWNDTLSQVVKKLGQQF
		     NKTTIVFKQSSGGDPEIAMHSFNCGGEFFYCNTTQLFNSTWNITGGTNITEGTNNMEG
		     NNTTIILPCRIKQMINMWQEVGKAMHAPPIQGIISCSSNITGLLLTRDGGNGNDTRDN
		     ETFRPGGGDMKDNWRSELYKYKVVKIEPFGVAPTKAKRRVVQREKR"
BASE COUNT	336 a	 125 c	  162 g    170 t
ORIGIN
       1 aattaggcca acagtatcaa ctcaattact gttaaatggc agtctagcag aaaaagaggt 
      61 agtaattaga tctgaaaatt tcacgaacaa tgctaaaacc ataatagtgc agctgacaac 
     121 acctgtagaa attaattgta taagacccaa caacaataca agaaaaagta tacctatagg 
     181 accagggaga gcactttata caacaggaga cataatagga aatataagaa aagcatgttg 
     241 taacattagt aaagcaaaat ggaatgacac tctaagccag gtagttaaaa aattaggaca 
     301 acaatttaat aaaacaacaa tagtctttaa gcaatcctca ggaggggacc cagaaattgc 
     361 aatgcacagt tttaactgtg gaggggaatt tttctactgt aatacaacac aattgtttaa 
     421 tagtacctgg aatattactg gaggaacaaa tattactgaa ggaacaaata acatggaagg 
     481 aaataataca acaatcatac tcccatgcag aataaaacaa atgataaaca tgtggcagga 
     541 ggtaggaaaa gcaatgcatg ccccgcccat ccaagggata attagctgct catcaaatat 
     601 tacagggcta ctactaacaa gagatggcgg taatggtaat gacaccagag ataatgagac 
     661 cttcagacct ggaggaggag atatgaagga caattggaga agtgaattat ataaatataa 
     721 agtagtaaaa attgaaccat ttggagtagc acccaccaag gcaaagagaa gggtggtgca 
     781 aagagaaaaa aga
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.