View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY032222 1107 bp RNA linear VRL 16-AUG-2001
DEFINITION HIV-1 isolate NC5975-2000 from USA pol polyprotein (pol) gene,
partial cds
ACCESSION AY032222
VERSION AY032222.1 GI:13739481
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 1107)
Show all sequences for reference 1
AUTHORS Shafer,R., Gonzales,M.J. and Brun-Vezinet,F.
TITLE Online comparison of HIV-1 drug resistance algorithms identifies
rates and causes of discordant interpretations
JOURNAL Antiviral Therapy 6 (Suppl. 1), 101 (2001)
REFERENCE 2 (bases 1 to 1107)
Show all sequences for reference 2
AUTHORS Gonzales,M.J., Machekano,R.N. and Shafer,R.W.
TITLE Direct Submission
JOURNAL Submitted (10-APR-2001) Medicine, Division of Infectious Diseases &
Geographic Medicine, Stanford University Medical Center, 300
Pasteur Drive, S-156, Stanford, CA 94305, USA
REFERENCE 3
Show all sequences for reference 3
AUTHORS Gonzales,M.J., Machekano,R.N. and Shafer,R.W.
TITLE Human immunodeficiency virus type 1 reverse-transcriptase and
protease subtypes: classification, amino acid mutation patterns,
and prevalence in a northern California clinic-based population
JOURNAL J. Infect. Dis. 184 (8), 998-1006 (2001)
PUBMED 11574914
REFERENCE 4
Show all sequences for reference 4
AUTHORS Gonzales,M.J., Johnson,E., Dupnik,K.M., Imamichi,T. and Shafer,R.W.
TITLE Colinearity of reverse transcriptase inhibitor resistance mutations
detected by population-based sequencing
JOURNAL J. Acquir. Immune Defic. Syndr. 34 (4), 398-402 (2003)
PUBMED 14615657
FEATURES Location/Qualifiers
source 1..1107
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="NC5975-2000"
/db_xref="taxon:11676"
/country="USA: Northern California"
gene <1..>1107
/gene="pol"
CDS <1..>1107
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol polyprotein"
/protein_id="AAK37037.1"
/db_xref="GI:13739482"
/translation="IVTIKIGGQLKEALLDTGADDTVLEEMTLPGKWKPKMIGGIGGF
VKVRQYEQVPVEICGHKAIGTVLVGPTPFNIIGRNLLTQLGCTLNFPISPIETVPVKL
KPGMDGPKVKQWPLTEEKIKALVEICTEXEKEGKISKIGPENPYNTPVFAIKKKNSTK
WRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDKDFRKYT
AFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDD
LYVGSDLEIGQHRTKIEELRHHLXKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPI
VLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQL"
BASE COUNT 436 a 175 c 230 g 261 t 5 other
ORIGIN
1 atcgtcacaa taaagatagg ggggcaacta aaggaagctc tattagatac aggagcagat
61 gatacagtat tagaagaaat gactttgcca ggaaaatgga aaccaaaaat gataggggga
121 attggaggat ttgtcaaagt aagacagtat gaacaggtac ccgtagaaat ctgtggacat
181 aaagctatag gtacagtatt agtaggacct acacctttca acataattgg aagaaatctg
241 ttgactcagc ttggttgcac tttaaatttt ccyattagtc ctattgaaac tgtaccagta
301 aaattaaaac caggaatgga tggcccaaaa gttaaacaat ggccattgac agaagagaaa
361 ataaaagcat tagtagaaat ttgtacagaa htggaaaagg aaggaaaaat ttcaaaaatt
421 gggcctgaaa atccatacaa tactccagta tttgccataa agaaaaagaa cagtactaaa
481 tggagaaaat tagtagattt cagagaactt aataagaaaa ctcaagactt ctgggaagtt
541 caattaggaa taccacaccc agcagggtta aaaaagaaca aatcagtaac agtactggat
601 gtgggcgatg catatttttc agttcctcta gataaagatt tcaggaagta tactgcattt
661 accataccta gtataaacaa tgagacacca gggattagat atcagtacaa tgtgcttcca
721 cagggatgga aaggatcacc agcaatattc caaagtagca tgacaaaaat cttagagcct
781 tttagaaaac aaaatccaga tatagtcatc tatcaatacg tggatgattt gtatgtagga
841 tctgacttag aaatagggca gcatagaaca aaaatagagg aactaagaca ccatctgtkg
901 aaatggggat tttacacacc agacaaaaaa catcagaaag aacctccatt cctttggatg
961 ggttatgaac tccatcctga taaatggaca gtacagccta tagtgctgcc agaraargac
1021 agctggactg tcaatgacat acagaagtta gtgggaaaat tgaattgggc aagtcagatt
1081 tacccaggga ttaaagtaaa gcaatta
//
last modified: Tue May 31 10:56 2022