View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY030604 971 bp RNA linear VRL 16-AUG-2001
DEFINITION HIV-1 isolate NC1469-1998 from USA pol polyprotein (pol) gene,
partial cds
ACCESSION AY030604
VERSION AY030604.1 GI:13736245
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 971)
Show all sequences for reference 1
AUTHORS Shafer,R., Gonzales,M.J. and Brun-Vezinet,F.
TITLE Online comparison of HIV-1 drug resistance algorithms identifies
rates and causes of discordant interpretations
JOURNAL Antiviral Therapy 6 (Suppl. 1), 101 (2001)
REFERENCE 2 (bases 1 to 971)
Show all sequences for reference 2
AUTHORS Gonzales,M.J., Machekano,R.N. and Shafer,R.W.
TITLE Direct Submission
JOURNAL Submitted (10-APR-2001) Medicine, Division of Infectious Diseases &
Geographic Medicine, Stanford University Medical Center, 300
Pasteur Drive, S-156, Stanford, CA 94305, USA
REFERENCE 3
Show all sequences for reference 3
AUTHORS Gonzales,M.J., Machekano,R.N. and Shafer,R.W.
TITLE Human immunodeficiency virus type 1 reverse-transcriptase and
protease subtypes: classification, amino acid mutation patterns,
and prevalence in a northern California clinic-based population
JOURNAL J. Infect. Dis. 184 (8), 998-1006 (2001)
PUBMED 11574914
REFERENCE 4
Show all sequences for reference 4
AUTHORS Rhee,S.-Y., Fessel,W.J., Liu,T.F., Marlowe,N.M., Rowland,C.M.,
Rode,R.A., Vandamme,A.-M., Van Laethem,K., Brun-Vezinet,F.,
Calvez,V., Taylor,J., Hurley,L., Horberg,M. and Shafer,R.W.
TITLE Predictive value of HIV-1 genotypic resistance test interpretation
algorithms.
JOURNAL J. Infect. Dis.. 200(3); 453-63 (2009)
PUBMED 19552527
FEATURES Location/Qualifiers
source 1..971
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="NC1469-1998"
/db_xref="taxon:11676"
/country="USA: Northern California"
gene <1..>971
/gene="pol"
CDS <1..>971
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol polyprotein"
/protein_id="AAK35419.1"
/db_xref="GI:13736246"
/translation="PQITLWQRPIVTIKIXGQLKEALLDTGADDTVLEEMDLPGRWKP
KVIVGIGGFSKVRQYDQIPIEICGHKIIGTVLIGPTPANIIGRNLLTQLGCTLNFPIS
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVF
AIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIP
LDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPD
IVIYQYMDDLYVGSDLEIGQXRTKVEELRQYLLKWGFFTPEQKHQKEP"
BASE COUNT 382 a 159 c 198 g 223 t 9 other
ORIGIN
1 cctcaaatca ctctttggca acgacccatc gtcacaataa agatagsagg gcaactaaag
61 gaagctctat tagatacagg agcagatgat acagtattag aagaaatgga tttgccagga
121 agatggaaac caaaagtgat agtgggaatt ggaggtttta gcaaagtgag acagtatgat
181 cagataccca tagaaatctg tggacataag attataggta cagtattaat aggacctaca
241 cctgcyaaca taattggaag aaatctgttg actcaacttg gttgcacttt aaattttccc
301 attagtccta ttgaaactgt accagtaaaa ttaaagccag gaatggatgg cccaaaagtt
361 aaacaatggc cattgacaga agaaaaaata aaagcattag tagaaatttg tacagaactg
421 gaaaargaag ggaaaatttc aaaaattggg cctgaaaatc catacaatac tccagtattt
481 gccataaaga aaaagaatag tactagatgg agaaaaatag tagayttcag rgaacttaay
541 aaragaactc aagacttctg ggaagttcaa ttaggaatac cacatcccgc agggttaaaa
601 aagaaaaaat cagtaacagt actggatgtg ggggatgcat atttttcaat tcccttagat
661 gaggacttca ggaagtatac tgcatttacc atacctagca craacaatga gacaccaggg
721 attaggtatc agtacaatgt gcttccacag ggatggaaag gatcaccagc aatattccaa
781 agtagcatga caaaaatctt agagcccttt agaaaacaaa atccagacat agttatctat
841 caatatatgg atgacttgta tgtaggatct gacttagaaa tagggcagca kagaacaaaa
901 gtagaggaac tgagacaata tctactcaag tgggggtttt tcacaccaga acaaaaacat
961 cagaaagaac c
//
last modified: Tue May 31 10:56 2022