View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF388157 1260 bp RNA linear VRL 16-NOV-2005
DEFINITION HIV-1 isolate 750 from Uganda pol protein (pol) gene, partial cds
ACCESSION AF388157
VERSION AF388157.1 GI:19071091
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 1260)
Show all sequences for reference 1
AUTHORS Eshleman,S.H., Becker-Pergola,G., Deseyve,M., Guay,L.A., Mracna,M.,
Fleming,T., Cunningham,S., Musoke,P., Mmiro,F. and Jackson,J.B.
TITLE Impact of human immunodeficiency virus type 1 (hiv-1) subtype on
women receiving single-dose nevirapine prophylaxis to prevent hiv-1
vertical transmission (hiv network for prevention trials 012 study)
JOURNAL J. Infect. Dis. 184 (7), 914-917 (2001)
PUBMED 11509999
REFERENCE 2 (bases 1 to 1260)
Show all sequences for reference 2
AUTHORS Eshleman,S.H., Guay,L.A., Wang,J., Mwatha,A., Brown,E.R.,
Musoke,P., Mmiro,F. and Jackson,J.B.
TITLE Distinct patterns of emergence and fading of K103N and Y181C in
women with subtype A vs. D after single-dose nevirapine: HIVNET 012
JOURNAL J. Acquir. Immune Defic. Syndr. 40 (1), 24-29 (2005)
PUBMED 16123677
REFERENCE 3 (bases 1 to 1260)
Show all sequences for reference 3
AUTHORS Becker-Pergola,G., Deseyve,M., Mracna,M., Guay,L.A., Cunningham,S.,
Musoke,P., Mmiro,F., Jackson,J.B. and Eshleman,S.H.
TITLE Direct Submission
JOURNAL Submitted (05-JUN-2001) Department of Pathology, Johns Hopkins
University, 720 Rutland Ave., Baltimore, MD 21205, USA
FEATURES Location/Qualifiers
source 1..1260
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="750"
/db_xref="taxon:11676"
/country="Uganda"
/note="from patient #750, 6-8 weeks post-partum mother
subtype: D"
gene <1..>1260
/gene="pol"
CDS <1..>1260
/gene="pol"
/note="protease and 5'' reverse transcriptase region"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="AAL84099.1"
/db_xref="GI:19071092"
/translation="PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEEINLPGKWKP
XMIGGIGGFIKVRQYDXILIEICGHKAIGTVLXGPTPVNIIGRNXLTQIGCTLNFPIS
PIXTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTXMEKEGKISRIGPENPYNTPIF
AIKKKDXTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVP
LDEDFRKYTAFTIPSXNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPE
MVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLXWGFTTPDKKHQKEPPFLWMGYELH
PDKWTVQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVI
PLTEEAELELAENREILKEPVHGVYYDP"
BASE COUNT 493 a 201 c 259 g 288 t 19 other
ORIGIN
1 cctcagatca ctctttggca acgacccctt gtyacaataa agatagaggg acagctaaag
61 gaagctctat tagatacagg agcagatgat acagtactag aagaaataaa tttgccagga
121 aaatggaaac caaraatgat agggggaatt ggaggtttta tcaaagtaag acagtatgat
181 samatactca tagaaatctg tggrcataaa gcyataggta cagtattrrt aggacctaca
241 cctgtcaata taattggaag aaatttkttg actcagattg gctgcacttt aaattttcca
301 atyagtccta ttamaactgt accagtaaaa ttaaagccag ggatggatgg cccaaaagtt
361 aaacaatggc cattgacaga agaaaaaata aaagcactaa cagaaatttg tacagakatg
421 gaaaaggaag gaaaaatttc aagaattggg cctgaaaatc catacaatac tccaatattt
481 gccataaaga aaaaggacrg tactaagtgg agaaaattag tagatttcag agaacttaat
541 aaaagaactc aagatttctg ggaagttcaa ctaggaatac crcatcctgc agggctaaaa
601 aagaaaaaat cagtaacagt actggatgtg ggtgatgcat atttttcagt tcccttagat
661 gaagacttta gaaagtatac tgcattcacc atacctagtr taaacaatga gacaccgggg
721 attagatatc agtacaatgt gcttccacag ggatggaaag gatcaccagc aatattccaa
781 agtagcatga caaaaatctt agaaccyttt agaaaacaaa atccagaaat ggttatctat
841 caatacatgg atgatttgta tgtaggatct gacttagaaa tagggcagca tagagcaaaa
901 atagaggaat taagggaaca tctattgarg tggggattta ccacaccaga caaaaaacat
961 cagaaagaac ctccatttct ttggatgggt tatgaactcc atcctgataa atggacagtg
1021 carcctatac aactgccaga aaaagaaagc tggactgtca atgatataca gaagttagtg
1081 gggaaattaa attgggcaag ccagatttat ccaggaatta aagtaaggca actatgtaaa
1141 ctccttaggg gagccaaagc actgacagaa gtaataccac tgacagaaga agcagaayta
1201 gaactggcag aaaacaggga gattctaaaa gaaccagtac atggagtgta ttatgaccca
//
last modified: Tue May 31 10:56 2022