View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF186541 297 bp RNA linear VRL 07-JUN-2000
DEFINITION HIV-1 clone CF1 protease (pol) gene, partial cds
ACCESSION AF186541
VERSION AF186541.1 GI:8307853
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 297)
Show all sequences for reference 1
AUTHORS Shafer,R.W., Warford,A., Winters,M.A. and Gonzales,M.J.
TITLE Reproducibility of human immunodeficiency virus type 1 (HIV-1)
protease and reverse transcriptase sequencing of plasma samples
from heavily treated HIV-1-infected individuals
JOURNAL J. Virol. Methods 86 (2), 143-153 (2000)
PUBMED 10785289
REFERENCE 2 (bases 1 to 297)
Show all sequences for reference 2
AUTHORS Shafer,R.W., Warford,A., Winters,M.A. and Gonzales,M.J.
TITLE Direct Submission
JOURNAL Submitted (16-SEP-1999) Medicine, Division of Infectious Diseases &
Geographic Medicine, Stanford University, Stanford University
Medical Center, Room S-156, Stanford, CA 94305, USA
FEATURES Location/Qualifiers
source 1..297
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/db_xref="taxon:11676"
/clone="CF1"
/note="sequence obtained through direct PCR sequencing of
plasma"
gene <1..>297
/gene="pol"
CDS <1..>297
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="protease"
/protein_id="AAF74357.1"
/db_xref="GI:8307854"
/translation="PQITLWQRPIVTVKIGGQIKEALLDTGADDTVLEEMNLPGRWKP
KLIGGIGGFIKVRQYDQIPIEICGHKVIGTVLIGPTPVNIIGRDLLTQIGCTLNF"
BASE COUNT 107 a 45 c 69 g 76 t
ORIGIN
1 cctcaaatca ctctttggca acgacccatc gtcacagtaa agataggggg gcaaataaag
61 gaagctctat tggatacagg agcagatgat acagtattag aagaaatgaa tttgccagga
121 agatggaaac caaaattgat agggggaatt ggaggtttta tcaaagtaag acagtatgat
181 cagataccca tagaaatctg tggacataaa gttataggta cagtattaat agggcctaca
241 cctgtcaaca taattggaag agatttgttg actcagattg gttgcactct aaatttt
//
last modified: Tue May 31 10:56 2022