View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF137713 597 bp DNA linear VRL 08-FEB-2000
DEFINITION HIV-1 p1c077-313 from USA envelope glycoprotein (env) gene, partial
cds
ACCESSION AF137713
VERSION AF137713.1 GI:6933977
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 597)
Show all sequences for reference 1
AUTHORS Shankarappa,R., Margolick,J.B., Gange,S., Gange,S.J., Rodrigo,A.G.,
Upchurch,D., Farzadegan,H., Gupta,P., Rinaldo,C.R., Learn,G.H.,
He,X., Huang,X.-L. and Mullins,J.I.
TITLE Consistent viral evolutionary changes associated with the
progression of human immunodeficiency virus type 1 infection
JOURNAL J. Virol. 73 (12), 10489-10502 (1999)
PUBMED 10559367
REFERENCE 2 (bases 1 to 597)
Show all sequences for reference 2
AUTHORS Shankarappa,R., Margolick,J.B., Farzadegan,H., Gange,S.J.,
Gupta,P., Rinaldo,C.R., Upchurch,D., Rodrigo,A.G., Learn,G.H.,
Huang,X.-L., Fan,Z. and Mullins,J.I.
TITLE Direct Submission
JOURNAL Submitted (26-MAR-1999) Department of Microbiology, University of
Washington, Box 357740, Seattle, WA 98195-7740, USA
REFERENCE 3
Show all sequences for reference 3
AUTHORS Jensen,M.A., Li,F., van 't Wout,A.B., Nickle,D.C., Shriner,D.,
He,H.-X., McLaughlin,S., Shankarappa,R., Margolick,J.B. and
Mullins,J.I.
CONSRTM Multicenter AIDS Cohort Study
TITLE Improved Coreceptor Usage Prediction and Genotypic Monitoring of
R5-to-X4 Transition by Motif Analysis of Human Immunodeficiency
Virus Type 1 env V3 Loop Sequences
JOURNAL J. Virol. 77 (24), 13376-13388 (2003)
PUBMED 14645592
COMMENT Sequences AF204402-204670, AF137629-138703, and AY348544-348333:
the 3-digit number in each sample name is months
post-seroconversion. Sampling years are estimated based on
enrollment in 1983-84 incremented by months post-seroconversion.
Data on viral load, CD4, and CD8 provided by J. Mullins [JM 3/06]
FEATURES Location/Qualifiers
source 1..597
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/db_xref="taxon:11676"
/clone="p1c077-313"
/country="USA"
gene <1..>597
/gene="env"
CDS <1..>597
/gene="env"
/note="gp120; C2-V5 region"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAF31580.1"
/db_xref="GI:6934114"
/translation="EKEVVIRSENFTDNAKTIIVQLNESVVINCTRPSNNTRRSIAVG
PGRAFYATDKIIGDIRKAHCNLSRTAWNNTLRQIVEKLREQFGNKTIVFNRSSGGDPE
IVMHSFNCGGEFFYCNTTQLFNSTWNTSTLNNATEGSETIILQCRIKQIINMWQEVGK
AMYAPPINGQIRCSSNITGLLLTRDGGNNINNTEIFRPG"
BASE COUNT 242 a 88 c 120 g 147 t
ORIGIN
1 gaaaaagagg tagtaattag atctgaaaat ttcacggaca atgctaaaac cataatagta
61 cagctgaatg agtctgtagt aattaattgt acaagaccca gtaacaatac aagaagaagt
121 atagcggtag gaccaggaag agcattttat gcaacagata aaataatagg agatataaga
181 aaagcacatt gtaaccttag tagaacagca tggaataaca ctttgagaca gatagttgaa
241 aaattaagag aacaatttgg gaataaaaca atagtcttta atcgatcctc aggaggggat
301 ccagaaattg tgatgcacag ttttaattgt ggaggggaat ttttctactg taatacaaca
361 caactgttta atagtacttg gaatactagt actttaaata atgctactga agggtcagag
421 acgatcatac tccaatgcag aataaaacaa attataaaca tgtggcagga agtaggaaaa
481 gcaatgtatg cccctcccat caacggacaa attagatgtt catcaaatat tacagggctg
541 ctattaacaa gagatggtgg caataacata aacaatactg aaatcttcag acctgga
//
last modified: Tue May 31 10:56 2022