View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF137685 609 bp DNA linear VRL 08-FEB-2000
DEFINITION HIV-1 p1c061-10 from USA envelope glycoprotein (env) gene, partial
cds
ACCESSION AF137685
VERSION AF137685.1 GI:6933949
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 609)
Show all sequences for reference 1
AUTHORS Shankarappa,R., Margolick,J.B., Gange,S., Gange,S.J., Rodrigo,A.G.,
Upchurch,D., Farzadegan,H., Gupta,P., Rinaldo,C.R., Learn,G.H.,
He,X., Huang,X.-L. and Mullins,J.I.
TITLE Consistent viral evolutionary changes associated with the
progression of human immunodeficiency virus type 1 infection
JOURNAL J. Virol. 73 (12), 10489-10502 (1999)
PUBMED 10559367
REFERENCE 2 (bases 1 to 609)
Show all sequences for reference 2
AUTHORS Shankarappa,R., Margolick,J.B., Farzadegan,H., Gange,S.J.,
Gupta,P., Rinaldo,C.R., Upchurch,D., Rodrigo,A.G., Learn,G.H.,
Huang,X.-L., Fan,Z. and Mullins,J.I.
TITLE Direct Submission
JOURNAL Submitted (26-MAR-1999) Department of Microbiology, University of
Washington, Box 357740, Seattle, WA 98195-7740, USA
REFERENCE 3
Show all sequences for reference 3
AUTHORS Jensen,M.A., Li,F., van 't Wout,A.B., Nickle,D.C., Shriner,D.,
He,H.-X., McLaughlin,S., Shankarappa,R., Margolick,J.B. and
Mullins,J.I.
CONSRTM Multicenter AIDS Cohort Study
TITLE Improved Coreceptor Usage Prediction and Genotypic Monitoring of
R5-to-X4 Transition by Motif Analysis of Human Immunodeficiency
Virus Type 1 env V3 Loop Sequences
JOURNAL J. Virol. 77 (24), 13376-13388 (2003)
PUBMED 14645592
COMMENT Sequences AF204402-204670, AF137629-138703, and AY348544-348333:
the 3-digit number in each sample name is months
post-seroconversion. Sampling years are estimated based on
enrollment in 1983-84 incremented by months post-seroconversion.
Data on viral load, CD4, and CD8 provided by J. Mullins [JM 3/06]
FEATURES Location/Qualifiers
source 1..609
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/db_xref="taxon:11676"
/clone="p1c061-10"
/country="USA"
gene <1..>609
/gene="env"
CDS <1..>609
/gene="env"
/note="gp120; C2-V5 region"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAF31552.1"
/db_xref="GI:6934086"
/translation="EKEVVIRSENFTDNAKTIIVQLNESVVINCTRPSNNTRKSIPVG
PGRAIYATGEIIGNIRQAHCNLSRAEWNNTLKQIVEKLREQSGNKTIVFNRSSGGDPE
IVMHSFNCGGEFFYCNSTQLFNSTWNSTLNNVTKGSNSTEENITLPCKIKQIINMWQE
VGKAMYAPPIRGQIRCSSNITGLLLTRDGGKNTSSTTEIFRPG"
BASE COUNT 247 a 94 c 124 g 144 t
ORIGIN
1 gaaaaagagg tagtaattag atctgaaaat ttcacggaca atgctaaaac cataatagta
61 cagctgaatg agtctgtagt aattaattgt acaagaccca gtaacaatac aagaaaaagt
121 ataccggtag gaccagggag agcaatttat gcaacaggag aaataatagg aaatataaga
181 caagcacatt gtaaccttag tagagcagaa tggaataaca ctttaaaaca gatagttgag
241 aaattaagag aacaatctgg gaataaaaca atagtcttta atcgatcctc aggaggggac
301 ccagaaattg taatgcacag ttttaattgt ggaggggaat ttttctactg taattcaaca
361 caactgttta atagtacttg gaatagtact ttgaataatg ttactaaagg gtcaaatagc
421 actgaagaga atatcacact cccatgcaaa ataaaacaaa ttataaacat gtggcaggaa
481 gtaggaaaag caatgtatgc ccctcccatc agaggacaaa ttagatgttc atcaaatatt
541 acagggctgc tattaacaag agatggtggt aagaacacga gcagcactac cgaaatcttc
601 agacctgga
//
last modified: Tue May 31 10:56 2022