View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF137665 597 bp DNA linear VRL 08-FEB-2000
DEFINITION HIV-1 p1c045-81 from USA envelope glycoprotein (env) gene, partial
cds
ACCESSION AF137665
VERSION AF137665.1 GI:6933929
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 597)
Show all sequences for reference 1
AUTHORS Shankarappa,R., Margolick,J.B., Gange,S., Gange,S.J., Rodrigo,A.G.,
Upchurch,D., Farzadegan,H., Gupta,P., Rinaldo,C.R., Learn,G.H.,
He,X., Huang,X.-L. and Mullins,J.I.
TITLE Consistent viral evolutionary changes associated with the
progression of human immunodeficiency virus type 1 infection
JOURNAL J. Virol. 73 (12), 10489-10502 (1999)
PUBMED 10559367
REFERENCE 2 (bases 1 to 597)
Show all sequences for reference 2
AUTHORS Shankarappa,R., Margolick,J.B., Farzadegan,H., Gange,S.J.,
Gupta,P., Rinaldo,C.R., Upchurch,D., Rodrigo,A.G., Learn,G.H.,
Huang,X.-L., Fan,Z. and Mullins,J.I.
TITLE Direct Submission
JOURNAL Submitted (26-MAR-1999) Department of Microbiology, University of
Washington, Box 357740, Seattle, WA 98195-7740, USA
REFERENCE 3
Show all sequences for reference 3
AUTHORS Jensen,M.A., Li,F., van 't Wout,A.B., Nickle,D.C., Shriner,D.,
He,H.-X., McLaughlin,S., Shankarappa,R., Margolick,J.B. and
Mullins,J.I.
CONSRTM Multicenter AIDS Cohort Study
TITLE Improved Coreceptor Usage Prediction and Genotypic Monitoring of
R5-to-X4 Transition by Motif Analysis of Human Immunodeficiency
Virus Type 1 env V3 Loop Sequences
JOURNAL J. Virol. 77 (24), 13376-13388 (2003)
PUBMED 14645592
COMMENT Sequences AF204402-204670, AF137629-138703, and AY348544-348333:
the 3-digit number in each sample name is months
post-seroconversion. Sampling years are estimated based on
enrollment in 1983-84 incremented by months post-seroconversion.
Data on viral load, CD4, and CD8 provided by J. Mullins [JM 3/06]
FEATURES Location/Qualifiers
source 1..597
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/db_xref="taxon:11676"
/clone="p1c045-81"
/country="USA"
gene <1..>597
/gene="env"
CDS <1..>597
/gene="env"
/note="gp120; C2-V5 region"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAF31532.1"
/db_xref="GI:6934066"
/translation="EEEVVIRSENFTDNAKTIIVQLKESVVINCTRPNNNTRKSMQVG
PGRAIYATGEIIGDIRQAHCNLSRAEWNNTLKQIAKKLREQFGNKTIVFNRSSGGDPE
IVMHSFNCGGEFFYCNTTQLFNSTWNTSTLNNVTEGSENITLPCRIKQIINMWQEVGK
AMYAPPIRGQIRCSSNITGLLLTRDGGSNTNNTEIFRPG"
BASE COUNT 242 a 90 c 123 g 142 t
ORIGIN
1 gaagaagagg tagtaattag atctgaaaat ttcacggaca atgctaaaac cataatagta
61 cagctaaagg agtctgtagt aattaattgt acaagaccca ataacaatac aagaaaaagt
121 atgcaggtag gaccagggag agcaatttat gcaacaggag aaataatagg agatataaga
181 caagcacatt gtaaccttag tagagcagaa tggaataaca ctttaaaaca gatagctaag
241 aaattaagag aacaatttgg gaataaaaca atagtcttta atcgatcctc aggaggggac
301 ccagaaattg tgatgcacag ttttaattgt ggaggggaat ttttctactg taatacaaca
361 caactgttta atagtacttg gaatactagt actttgaata atgttactga agggtcagag
421 aatatcacac tcccatgcag aataaaacaa attataaaca tgtggcagga agtaggaaaa
481 gcaatgtatg cccctcccat cagaggacaa attagatgtt catcaaatat tacagggctg
541 ctattaacaa gagatggtgg cagtaacaca aacaatactg aaatcttcag acctgga
//
last modified: Tue May 31 10:56 2022