View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF116059 502 bp DNA linear VRL 19-JUN-2000
DEFINITION HIV-1 isolate D36 H1&2 from Australia gag protein (gag) gene,
partial cds
ACCESSION AF116059
VERSION AF116059.1 GI:8571880
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 502)
Show all sequences for reference 1
AUTHORS Tsykin,A., Weiller,G. and Deacon,N.
TITLE Replication rate of an attenuated HIV-1
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 502)
Show all sequences for reference 2
AUTHORS Tsykin,A., Weiller,G. and Deacon,N.
TITLE Direct Submission
JOURNAL Submitted (22-DEC-1998) Research School of Biological Sciences,
Australian National University, GPO 475, Canberra, ACT 2601,
Australia
REFERENCE 3
Show all sequences for reference 3
AUTHORS Deacon,N.J., Tsykin,A., Solomon,A., Smith,K., Ludford-Menting,M.,
Hooker,D.J., McPhee,D.A., Greenway,A.L., Ellett,A., Chatfield,C.,
Lawson,V.A., Crowe,S., Maerz,A., Sonza,S., Learmont,J.,
Sullivan,J.S., Cunningham,A., Dwyer,D., Dowton,D. and Mills,J.
TITLE Genomic structure of an attenuated quasi species of HIV-1 from a
blood transfusion donor and recipients
JOURNAL Science 270 (5238), 988-991 (1995)
PUBMED 7481804
FEATURES Location/Qualifiers
source 1..502
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="D36 H1&2"
/db_xref="taxon:11676"
/country="Australia"
/note="Sydney Blood Bank Cohort, nef/LTR deletions
subtype: B"
gene <1..>502
/gene="gag"
CDS <1..>502
/gene="gag"
/note="p17; p24"
/codon_start="1"
/transl_table="1"
/product="gag protein"
/protein_id="AAF76911.1"
/db_xref="GI:8571881"
/translation="SVLSGGELDRWEKIRLRPGGRKKYQLKHIVWASRELERFAVNPG
LLETSEGCRQILGQLHPTLPTGSEELKSLYNTVAVLYCVHQRIEVKDTKEALEKIEEE
QNKCKKKAQQAAAGTGNSSQVSQNYPIVQNMQGQMVHQAISPRTLNAWVKVVEEKAFS
PEVIPMF"
BASE COUNT 194 a 89 c 123 g 96 t
ORIGIN
1 tcagtattaa gcgggggaga attagataga tgggaaaaaa ttcggttacg gccaggagga
61 aggaaaaaat atcaattaaa acatatagta tgggcaagca gggagctaga acgattcgca
121 gttaatcctg gcctgttaga aacatcagaa ggctgtagac aaatactggg gcagttacac
181 ccaacccttc cgacaggatc agaagaactt aagtcattat ataatacagt agcagtcctc
241 tattgtgtgc atcaaagaat agaggtaaaa gacaccaagg aagctttaga gaagatagag
301 gaagagcaaa acaaatgtaa gaaaaaagca cagcaagcag cagctggcac aggaaacagc
361 agccaggtca gccaaaatta ccctatagtg cagaacatgc aggggcaaat ggtgcatcag
421 gccatatcac ctagaacttt aaatgcatgg gtaaaagtag tagaagagaa ggctttcagc
481 ccagaagtaa tacccatgtt ta
//
last modified: Tue May 31 10:56 2022