View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF030686 130 bp DNA linear VRL 23-OCT-2001
DEFINITION HIV-1 clone US94contH.d4 from the USA, pol protein (pol) gene,
partial cds
ACCESSION AF030686
VERSION AF030686.1 GI:2898098
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 130)
Show all sequences for reference 1
AUTHORS Zhu,T., Korber,B.T., Nahmias,A.J., Hooper,E., Sharp,P.M. and
Ho,D.D.
TITLE An African HIV-1 sequence from 1959 and implications for the origin
of the epidemic
JOURNAL Nature 391 (6667), 594-597 (1998)
PUBMED 9468138
REFERENCE 2 (bases 1 to 130)
Show all sequences for reference 2
AUTHORS Korber,B., Zhu,T., Nahmias,A., Hooper,E., Sharp,P. and Ho,D.
TITLE Direct Submission
JOURNAL Submitted (21-OCT-1997) HIV Database, Group T10, Los Alamos
National Laboratory, MS K710, Los Alamos, NM 87545, USA
FEATURES Location/Qualifiers
source 1..130
/organism="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/db_xref="taxon:11676"
/clone="US94contH.d4"
/note="1994 sample from a heterosexual source; from the
USA"
gene <1..>130
/gene="pol"
CDS <1..>130
/gene="pol"
/codon_start="2"
/transl_table="1"
/product="pol protein"
/protein_id="AAC09224.1"
/db_xref="GI:2898099"
/translation="KYARMRGAHTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQK"
BASE COUNT 59 a 22 c 26 g 23 t
ORIGIN
1 aaagtatgca agaatgaggg gggcccacac taatgatgtt aaacaattaa cagaggcagt
61 gcaaaaaata gccacagaaa gcatagtaat atggggaaag actcctaaat ttaaactacc
121 catacaaaaa
//
last modified: Tue May 31 10:56 2022