View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF030655 170 bp DNA linear VRL 02-APR-1998
DEFINITION HIV-1 clone 7 Zairean 1959 sample, envelope glycoprotein (env)
gene, partial cds
ACCESSION AF030655
VERSION AF030655.1 GI:2898037
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 170)
Show all sequences for reference 1
AUTHORS Zhu,T., Korber,B.T., Nahmias,A.J., Hooper,E., Sharp,P.M. and
Ho,D.D.
TITLE An African HIV-1 sequence from 1959 and implications for the origin
of the epidemic
JOURNAL Nature 391 (6667), 594-597 (1998)
PUBMED 9468138
REFERENCE 2 (bases 1 to 170)
Show all sequences for reference 2
AUTHORS Korber,B., Zhu,T., Nahmias,A., Hooper,E., Sharp,P. and Ho,D.
TITLE Direct Submission
JOURNAL Submitted (21-OCT-1997) HIV Database, Group T10, Los Alamos
National Laboratory, MS K710, Los Alamos, NM 87545, USA
FEATURES Location/Qualifiers
source 1..170
/organism="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/db_xref="taxon:11676"
/clone="7"
/note="Zairean 1959 sample; fragment c"
gene <1..>170
/gene="env"
CDS <1..>170
/gene="env"
/codon_start="2"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAC09194.1"
/db_xref="GI:2898038"
/translation="QYWSQELKNSAISLLDATAIAVAEGTDRIIEVVQRACRAVLHIP
TRIRQGLERALL"
BASE COUNT 57 a 29 c 45 g 39 t
ORIGIN
1 gcagtattgg agccaggaac taaagaatag tgctattagc ttgcttgatg ccacagcaat
61 agcagtagct gaggggacag ataggattat agaagtagta caaagagctt gtagagctgt
121 cctccacata cctacaagaa taagacaggg cttggaaaga gctttgctat
//
last modified: Tue May 31 10:56 2022