HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    AF009392		    1176 bp    DNA     linear	VRL 11-AUG-1997
DEFINITION  HIV-1 isolate 92TH022 from Thailand, pol polyprotein (pol) gene,
	    partial cds
ACCESSION   AF009392
VERSION     AF009392.1 GI:2338331
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 1176)
            Show all sequences for reference 1
  AUTHORS   Cornelissen,M., van Den Burg,R., Zorgdrager,F., Lukashov,V. and
	    Goudsmit,J.
  TITLE     pol gene diversity of five human immunodeficiency virus type 1
	    subtypes: evidence for naturally occurring mutations that
	    contribute to drug resistance, limited recombination patterns, and
	    common ancestry for subtypes B and D
  JOURNAL   J. Virol. 71 (9), 6348-6358 (1997)
  PUBMED    9261352
REFERENCE   2 (bases 1 to 1176)
            Show all sequences for reference 2
  AUTHORS   Cornelissen,M.T.E., Van de Burg,R., Zorgdrager,F., Lukashov,V. and
	    Goudsmit,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-JUN-1997) Department of Human Retrovirus Laboratory,
	    Academic Medical Centre, Meibergdreef 15, Amsterdam 1105AZ, The
	    Netherlands
REFERENCE   3
            Show all sequences for reference 3
  AUTHORS   WHO Global Programme on AIDS. and WHO Global Programme on AIDS
  TITLE     HIV type 1 variation in World Health Organization-sponsored vaccine
	    evaluation sites: genetic screening, sequence analysis, and
	    preliminary biological characterization of selected viral strains.
	    WHO Network for HIV Isolation and Characterization
  JOURNAL   AIDS Res. Hum. Retroviruses 10 (11), 1327-1343 (1994)
  PUBMED    7545977
COMMENT     Isolated from seropositive individual in Thailand (TH) for the
	    UNAIDS Network for HIV Isolation and Characterization. Biotypes
	    were determined by MT-2 syncytium assay; however, both
	    syncytium-inducing (SI) and non-syncytium-inducing (NSI) variants
	    may be present in the viral "swarm" for each isolate. Recent
	    studies indicate that NSI isolates contain predominantly CCR5-using
	    variants while most SI isolates contain both CXCR4 (SI) and CCR5
	    (NSI) variants. Some SI isolates may contain dual-tropic variants
	    that use both CXCR4 and CCR5 co-receptors. The isolate 92TH022 is
	    available from the NIH AIDS Reagent program, and is NSI R5.
FEATURES             Location/Qualifiers
     source	     1..1176
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="92TH022"
		     /db_xref="taxon:11676"
     gene	     <1..>1176
		     /gene="pol"
     CDS	     <1..>1176
		     /gene="pol"
		     /codon_start="1"
		     /transl_table="1"
		     /product="pol polyprotein"
		     /protein_id="AAC58222.1"
		     /db_xref="GI:2338332"
		     /translation="LWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIG
		     GIGGFIKVRQYDQILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNFPISPIDT
		     VPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKK
		     KDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDES
		     FRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRMKNPEMIIY
		     QYMDELYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRW
		     TVQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTE
		     "
BASE COUNT	459 a	 189 c	  253 g    275 t
ORIGIN
       1 ctttggcaac gaccccttgt cacaataaaa ataggaggac agctgaaaga agctctatta 
      61 gatacaggag cagatgatac agtattagaa gatataaatt tgccaggaaa atggaaacca 
     121 aaaatgatag ggggaattgg aggttttatc aaggtaaggc aatatgatca gatacttata 
     181 gaaatttgtg gaaaaaaggc tataggtaca gtattagtag gacctacgcc tgtcaacata 
     241 attggacgaa atatgttgac tcagcttggt tgtactttaa atttcccaat tagtcctatt 
     301 gacactgtac cagtaacatt aaagccagga atggatggac caaaggttaa acaatggcca 
     361 ttgacagaag aaaaaataaa agcattaaca gaaatttgta aagagatgga agaggaagga 
     421 aaaatttcaa aaattgggcc tgaaaatcca tacaatactc cagtatttgc tataaagaaa 
     481 aaggatagca ccaaatggag gaaattagta gatttcagag agctcaataa aagaactcag 
     541 gacttttggg aagttcaatt aggaataccg catccagcag gtttaaaaaa gaaaaaatca 
     601 gtaacagtac tagatgtggg agatgcatat ttttcagttc ctttagatga aagctttaga 
     661 aagtatactg cattcaccat acctagtata aacaatgaga caccaggaat cagatatcaa 
     721 tacaatgtgc tgccacaggg atggaaagga tcaccggcaa tattccagag tagcatgaca 
     781 aaaatcttag agccctttag aatgaaaaat ccagaaatga ttatctacca atacatggat 
     841 gagttatatg taggatctga tttagaaata gggcagcaca gaacgaaaat agaggagcta 
     901 agagctcatc tattgagctg gggatttact acaccagaca aaaagcatca gaaggaacct 
     961 ccattccttt ggatgggata tgaactccat cctgacagat ggacagtcca gcctatagaa 
    1021 ctgccagaaa aagacagctg gactgtcaat gatatacaga aattagtggg aaaactaaat 
    1081 tgggcaagtc aaatttatgc agggattaag gtaaagcaac tgtgtaaact cctcagggga 
    1141 gctaaagcac taacagacat agtaccactg actgaa
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.