View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AB475167 183 bp RNA linear VRL 23-MAY-2009
DEFINITION Human immunodeficiency virus 1 gag gene for gag polyprotein,
partial cds, isolate: KI-007, clone: 15, HLA-B44 restricted CTL
epitopes region
ACCESSION AB475167
VERSION AB475167.1 GI:238003534
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1
Show all sequences for reference 1
AUTHORS Kawashima,Y., Pfafferott,K., Frater,J., Matthews,P., Payne,R.,
Addo,M., Gatanaga,H., Fujiwara,M., Hachiya,A., Koizumi,H., Kuse,N.,
Oka,S., Duda,A., Prendergast,A., Crawford,H., Leslie,A., Brumme,Z.,
Brumme,C., Allen,T., Brander,C., Kaslow,R., Tang,J., Hunter,E.,
Allen,S., Mulenga,J., Branch,S., Roach,T., John,M., Mallal,S.,
Ogwu,A., Shapiro,R., Prado,J.G., Fidler,S., Weber,J., Pybus,O.G.,
Klenerman,P., Ndung'u,T., Phillips,R., Heckerman,D.,
Harrigan,P.R., Walker,B.D., Takiguchi,M. and Goulder,P.
TITLE Adaptation of HIV-1 to human leukocyte antigen class I
JOURNAL Nature 458 (7238), 641-645 (2009)
PUBMED 19242411
REFERENCE 2 (bases 1 to 183)
Show all sequences for reference 2
AUTHORS Kawashima,Y., Naruto,T., Gatanaga,H., Hachiya,A., Koizumi,H.,
Kuse,N., Oka,S. and Takiguchi,M.
TITLE Direct Submission
JOURNAL Submitted (08-JAN-2009) Contact:Takuya Naruto Center for AIDS
Research, Kumamoto University, Viral Immunology; 2-2-1 Honjo,
Kumamoto, Kumamoto 860-0811, Japan
FEATURES Location/Qualifiers
source 1..183
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="KI-007"
/db_xref="taxon:11676"
/clone="15"
gene <1..>183
/gene="gag"
CDS <1..>183
/gene="gag"
/note="HLA-B44 restricted CTL epitopes region"
/codon_start="2"
/transl_table="1"
/product="gag polyprotein"
/protein_id="BAH59668.1"
/db_xref="GI:238003535"
/translation="LRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMM
TACQGVGGPGHKARVLA"
BASE COUNT 65 a 33 c 50 g 35 t
ORIGIN
1 tctaagagca gagcaagcct cacaggaggt aaaaaattgg atgacagaaa ccttgttggt
61 ccaaaatgca aacccagatt gtaagaccat tttaaaagca ttggggccag gagctacatt
121 agaagaaatg atgacagcat gccagggagt gggaggacct ggccataaag caagagtttt
181 ggc
//
last modified: Tue May 31 10:56 2022