View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AB005329 102 bp RNA linear VRL 14-NOV-2007
DEFINITION Human immunodeficiency virus 1 env gene for envelope glycoprotein,
partial cds, viral sequence N08-1
ACCESSION AB005329
VERSION AB005329.1 GI:3628623
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1
Show all sequences for reference 1
AUTHORS Ida,S., Gatanaga,H., Shioda,T., Nagai,Y., Kobayashi,N., Shimada,K.,
Kimura,S., Iwamoto,A. and Oka,S.
TITLE HIV type 1 V3 variation dynamics in vivo: long-term persistence of
non-syncytium-inducing genotypes and transient presence of
syncytium-inducing genotypes during the course of progressive AIDS
JOURNAL AIDS Res. Hum. Retroviruses 13 (18), 1597-1609 (1997)
PUBMED 9430252
REFERENCE 2 (bases 1 to 102)
Show all sequences for reference 2
AUTHORS Ida,S.
TITLE Direct Submission
JOURNAL Submitted (23-JUN-1997) Setsuko Ida, International Medical Center
of Japan, AIDS clinical center; 1-21-1 Toyama, Sinjyuku, Tokyo
162-8655, Japan (E-mail:sida@info.ncc.go.jp, Tel:81-3-5273-5277)
FEATURES Location/Qualifiers
source 1..102
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="TK-22"
/db_xref="taxon:11676"
/note="synonym: Human immunodeficiency virus type 1; viral
sequence N08-1"
gene <1..>102
/gene="env"
CDS <1..>102
/gene="env"
/note="V3 region"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="BAA33247.1"
/db_xref="GI:4432622"
/translation="CTRPNNNTRKSIPIGPGRAFYTTNIIGNIRQAYC"
BASE COUNT 49 a 18 c 16 g 19 t
ORIGIN
1 tgtacaagac ccaacaacaa cacaagaaaa agtataccta taggaccagg gagagcattt
61 tatacaacaa acataatagg aaatataaga caagcatatt gt
//
last modified: Tue May 31 10:56 2022